SCOPe 2.03: Domain d2h9gl2: 2h9g L:108-211

Lineage for d2h9gl2 (2h9g L:108-211)

Root: SCOPe 2.03
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (12 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (293 PDB entries)
Domain d2h9gl2: 2h9g L:108-211 [197999]
Other proteins in same PDB: d2h9ga1, d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2, d2h9gl1, d2h9gr1, d2h9gr2, d2h9gr3, d2h9gs1
automated match to d1rhha2

Details for d2h9gl2

PDB Entry: 2h9g (more details), 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)

PDB Compounds: (L:) Fab BdF1, light chain

SCOPe Domain Sequences for d2h9gl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9gl2 b.1.1.2 (L:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2h9gl2:

Click to download the PDB-style file with coordinates for d2h9gl2.
(The format of our PDB-style files is described here.)

Timeline for d2h9gl2: