![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (29 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
![]() | Domain d2h9ga1: 2h9g A:1-107 [197996] Other proteins in same PDB: d2h9ga2, d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2, d2h9gl2, d2h9gr1, d2h9gr2, d2h9gr3, d2h9gs1 automated match to d1rhha1 |
PDB Entry: 2h9g (more details), 2.32 Å
SCOPe Domain Sequences for d2h9ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h9ga1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik
Timeline for d2h9ga1: