Lineage for d2h9ga1 (2h9g A:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1296347Domain d2h9ga1: 2h9g A:1-107 [197996]
    Other proteins in same PDB: d2h9ga2, d2h9gb1, d2h9gb2, d2h9gh1, d2h9gh2, d2h9gl2, d2h9gr1, d2h9gr2, d2h9gr3, d2h9gs1
    automated match to d1rhha1

Details for d2h9ga1

PDB Entry: 2h9g (more details), 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)
PDB Compounds: (A:) Fab BdF1, light chain

SCOPe Domain Sequences for d2h9ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h9ga1 b.1.1.0 (A:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik

SCOPe Domain Coordinates for d2h9ga1:

Click to download the PDB-style file with coordinates for d2h9ga1.
(The format of our PDB-style files is described here.)

Timeline for d2h9ga1: