SCOPe 2.05: Domain d2gz3b2: 2gz3 B:128-329

Lineage for d2gz3b2 (2gz3 B:128-329)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
   core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1

4. Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families)
   N-terminal domain is the classic Rossmann-fold

5. Family d.81.1.1: GAPDH-like [55348] (6 proteins)
   has many additional secondary structures

6. Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [143538] (18 PDB entries)
   Uniprot Q8DQ00 128-329

8. Domain d2gz3b2: 2gz3 B:128-329 [197993]
   Other proteins in same PDB: d2gz3a1, d2gz3b1, d2gz3c1, d2gz3d1
   automated match to d2gyya2
   complexed with as2, nap

Details for d2gz3b2

PDB Entry: 2gz3, 2.1 Å

PDB Description: Structure of Aspartate Semialdehyde Dehydrogenase (ASADH) from Streptococcus pneumoniae complexed with NADP and aspartate-semialdehyde

PDB Compounds: (B:) Aspartate beta-semialdehyde dehydrogenase

SCOPe Domain Sequences for d2gz3b2:

Sequence; same for both SEQRES and ATOM records:

>d2gz3b2 d.81.1.1 (B:128-329) Aspartate beta-semialdehyde dehydrogenase {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
cstiqmmvalepvrqkwgldriivstyqavsgagmgailetqrelrevlndgvkpcdlha
eilpsggdkkhypiafnalpqidvftdndytyeemkmtketkkimeddsiavsatcvrip
vlsahsesvyietkevapieevkaaiaafpgavleddvahqiypqainavgsrdtfvgri
rkdldaekgihmwvvsdnllkg

Timeline for d2gz3b2:

• d2gz3b2 first appeared in SCOPe 2.03
  
• d2gz3b2 appears in SCOPe 2.04
  
• d2gz3b2 appears in SCOPe 2.06
  
• d2gz3b2 appears in the current release, SCOPe 2.08