Lineage for d1hinl1 (1hin L:1-108)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7343Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)
  8. 7355Domain d1hinl1: 1hin L:1-108 [19796]
    Other proteins in same PDB: d1hinh2, d1hinl2

Details for d1hinl1

PDB Entry: 1hin (more details), 3.1 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody-antigen recognition

SCOP Domain Sequences for d1hinl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hinl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

SCOP Domain Coordinates for d1hinl1:

Click to download the PDB-style file with coordinates for d1hinl1.
(The format of our PDB-style files is described here.)

Timeline for d1hinl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hinl2