Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (20 species) not a true protein |
Species Sphingobium yanoikuyae [TaxId:13690] [225237] (2 PDB entries) |
Domain d2gbxe2: 2gbx E:153-454 [197949] Other proteins in same PDB: d2gbxa1, d2gbxb_, d2gbxc1, d2gbxd_, d2gbxe1, d2gbxf_ automated match to d1eg9a2 complexed with bnl, fe, fes, zn |
PDB Entry: 2gbx (more details), 2.8 Å
SCOPe Domain Sequences for d2gbxe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gbxe2 d.129.3.0 (E:153-454) automated matches {Sphingobium yanoikuyae [TaxId: 13690]} eapsledylgefryyldtiwegagggmellgppmksllqcnwkvpaenfigdgyhvgwth aaalsqiggelaglagnradipfddlglqfttrhghgfgvidnaaaglhikregwtkfle dtrgevrrkfgpererlylghwncsifpncsflygtntfkiwhprgpheievwtytivpr dadpatksmiqreairtfgtagtlesddgenmssatyinrgvitrngrmnstmgvgyegp hpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddtwdsvfpnrnfwneklna ae
Timeline for d2gbxe2: