SCOPe 2.06: Domain d2gbxa1: 2gbx A:6-152

Lineage for d2gbxa1 (2gbx A:6-152)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (11 species)
   not a true protein

7. Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)

8. Domain d2gbxa1: 2gbx A:6-152 [197944]
   Other proteins in same PDB: d2gbxa2, d2gbxb_, d2gbxc2, d2gbxd_, d2gbxe2, d2gbxf_
   automated match to d1o7na1
   complexed with bnl, fe, fes, zn

Details for d2gbxa1

PDB Entry: 2gbx, 2.8 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl

PDB Compounds: (A:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbxa1:

Sequence; same for both SEQRES and ATOM records:

>d2gbxa1 b.33.1.0 (A:6-152) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
tlvdtvnasqsrqvfwdedvyaleierifsrawlmlgheslvpkpgdfittymaedkvil
shqsdgtfrafinscshrgnqichadsgnakafvcnyhgwvfgqdgslvdvplesrcyhn
sldkqklaaksvrvetykgfifgchdp

Timeline for d2gbxa1:

• d2gbxa1 first appeared in SCOPe 2.03
  
• d2gbxa1 appears in SCOPe 2.05
  
• d2gbxa1 appears in SCOPe 2.07
  
• d2gbxa1 appears in the current release, SCOPe 2.08