Lineage for d2gbwc2 (2gbw C:153-451)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926677Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 1926678Protein automated matches [190218] (20 species)
    not a true protein
  7. 1926820Species Sphingobium yanoikuyae [TaxId:13690] [225237] (2 PDB entries)
  8. 1926822Domain d2gbwc2: 2gbw C:153-451 [197941]
    Other proteins in same PDB: d2gbwa1, d2gbwb_, d2gbwc1, d2gbwd_, d2gbwe1, d2gbwf_
    automated match to d1eg9a2
    complexed with fe, fes, oxy

Details for d2gbwc2

PDB Entry: 2gbw (more details), 1.7 Å

PDB Description: crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1
PDB Compounds: (C:) Biphenyl 2,3-Dioxygenase Alpha Subunit

SCOPe Domain Sequences for d2gbwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gbwc2 d.129.3.0 (C:153-451) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
eapsledylgefryyldtiwegagggmellgppmksllqcnwkvpaenfigdgyhvgwth
aaalsqiggelaglagnradipfddlglqfttrhghgfgvidnaaaglhikregwtkfle
dtrgevrrkfgpererlylghwncsifpncsflygtntfkiwhprgpheievwtytivpr
dadpatksmiqreairtfgtagtlesddgenmssatyinrgvitrngrmnstmgvgyegp
hpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddtwdsvfpnrnfwnekln

SCOPe Domain Coordinates for d2gbwc2:

Click to download the PDB-style file with coordinates for d2gbwc2.
(The format of our PDB-style files is described here.)

Timeline for d2gbwc2: