Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d2g60l2: 2g60 L:109-208 [197937] Other proteins in same PDB: d2g60h1, d2g60l1 automated match to d2jell2 |
PDB Entry: 2g60 (more details), 1.85 Å
SCOPe Domain Sequences for d2g60l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g60l2 b.1.1.0 (L:109-208) automated matches {Mouse (Mus musculus) [TaxId: 10090]} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivks
Timeline for d2g60l2: