Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.1: ISP transmembrane anchor [81501] (2 proteins) |
Protein Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region [81500] (3 species) |
Species Cow (Bos taurus) [TaxId:9913] [81497] (17 PDB entries) Uniprot P13272; precursor of chains I,E and V,R |
Domain d2fyue1: 2fyu E:1-69 [197933] Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuj_, d2fyuk_ automated match to d1ntme2 complexed with fdn, fes, hem |
PDB Entry: 2fyu (more details), 2.26 Å
SCOPe Domain Sequences for d2fyue1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fyue1 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs smsasadvl
Timeline for d2fyue1: