Lineage for d1himh1 (1him H:1-108)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653334Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (35 PDB entries)
  8. 653375Domain d1himh1: 1him H:1-108 [19793]
    Other proteins in same PDB: d1himh2, d1himj2, d1himl1, d1himl2, d1himm1, d1himm2

Details for d1himh1

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition
PDB Compounds: (H:) igg2a-kappa 17/9 fab (heavy chain)

SCOP Domain Sequences for d1himh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1himh1 b.1.1.1 (H:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

SCOP Domain Coordinates for d1himh1:

Click to download the PDB-style file with coordinates for d1himh1.
(The format of our PDB-style files is described here.)

Timeline for d1himh1: