Lineage for d1himl1 (1him L:1-112)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2021582Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2021955Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (59 PDB entries)
    Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10
  8. 2022022Domain d1himl1: 1him L:1-112 [19792]
    Other proteins in same PDB: d1himh1, d1himh2, d1himj1, d1himj2, d1himl2, d1himm2
    part of Fab 17/9; chain identifiers are mixed up

Details for d1himl1

PDB Entry: 1him (more details), 2.9 Å

PDB Description: structural evidence for induced fit as a mechanism for antibody- antigen recognition
PDB Compounds: (L:) igg2a-kappa 17/9 fab (heavy chain)

SCOPe Domain Sequences for d1himl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1himl1 b.1.1.1 (L:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvs

SCOPe Domain Coordinates for d1himl1:

Click to download the PDB-style file with coordinates for d1himl1.
(The format of our PDB-style files is described here.)

Timeline for d1himl1: