SCOPe 2.05: Domain d2fjna_: 2fjn A:

Lineage for d2fjna_ (2fjn A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (7 proteins)
   has an extension to the beta-sheet of 3 antiparallel strands before strand 4

6. Protein Tyrosine phosphatase [52806] (7 species)

7. Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (114 PDB entries)
   Uniprot P18031 2-300 ! Uniprot P18031 1-298 ! Uniprot P18031 2-299

8. Domain d2fjna_: 2fjn A: [197918]
   automated match to d1q6sa_
   complexed with 073, cl

Details for d2fjna_

PDB Entry: 2fjn, 2.2 Å

PDB Description: the structure of phosphotyrosine phosphatase 1b in complex with compound 2

PDB Compounds: (A:) Tyrosine-protein phosphatase, non-receptor type 1

SCOPe Domain Sequences for d2fjna_:

Sequence; same for both SEQRES and ATOM records:

>d2fjna_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]}
klefmemekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsr
iklhqedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmek
gslkcaqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhy
ttwpdfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmd
krkdpssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgds

Timeline for d2fjna_:

• d2fjna_ first appeared in SCOPe 2.03
  
• d2fjna_ appears in SCOPe 2.04
  
• d2fjna_ is called d2fjna1 in SCOPe 2.06
  
• d2fjna_ appears in the current release, SCOPe 2.08, called d2fjna1