Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d2fjga2: 2fjg A:108-211 [197915] Other proteins in same PDB: d2fjga1, d2fjgb1, d2fjgb2, d2fjgh1, d2fjgh2, d2fjgl1, d2fjgv_, d2fjgw_ automated match to d1rhha2 complexed with so4 |
PDB Entry: 2fjg (more details), 2.8 Å
SCOPe Domain Sequences for d2fjga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fjga2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d2fjga2: