Lineage for d2fjga2 (2fjg A:108-211)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1763359Domain d2fjga2: 2fjg A:108-211 [197915]
    Other proteins in same PDB: d2fjga1, d2fjgb1, d2fjgb2, d2fjgh1, d2fjgh2, d2fjgl1, d2fjgv_, d2fjgw_
    automated match to d1rhha2
    complexed with so4

Details for d2fjga2

PDB Entry: 2fjg (more details), 2.8 Å

PDB Description: Structure of the G6 Fab, a phage derived Fab fragment, in complex with VEGF
PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d2fjga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjga2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2fjga2:

Click to download the PDB-style file with coordinates for d2fjga2.
(The format of our PDB-style files is described here.)

Timeline for d2fjga2: