SCOPe 2.08: Domain d2fjga2: 2fjg A:108-211

Lineage for d2fjga2 (2fjg A:108-211)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d2fjga2: 2fjg A:108-211 [197915]
Other proteins in same PDB: d2fjga1, d2fjgb_, d2fjgh_, d2fjgl1, d2fjgv_, d2fjgw_
automated match to d1rhha2
complexed with so4

Details for d2fjga2

PDB Entry: 2fjg (more details), 2.8 Å

PDB Description: Structure of the G6 Fab, a phage derived Fab fragment, in complex with VEGF

PDB Compounds: (A:) Fab light chain

SCOPe Domain Sequences for d2fjga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fjga2 b.1.1.2 (A:108-211) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

SCOPe Domain Coordinates for d2fjga2:

Click to download the PDB-style file with coordinates for d2fjga2.
(The format of our PDB-style files is described here.)

Timeline for d2fjga2: