SCOPe 2.05: Domain d2fjfq1: 2fjf Q:1-107

Lineage for d2fjfq1 (2fjf Q:1-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2fjfq1: 2fjf Q:1-107 [197906]
   Other proteins in same PDB: d2fjfa2, d2fjfb1, d2fjfb2, d2fjfc2, d2fjfd1, d2fjfd2, d2fjfe2, d2fjff1, d2fjff2, d2fjfg2, d2fjfh1, d2fjfh2, d2fjfi1, d2fjfi2, d2fjfj2, d2fjfk1, d2fjfk2, d2fjfl2, d2fjfm2, d2fjfn1, d2fjfn2, d2fjfo2, d2fjfp1, d2fjfp2, d2fjfq2, d2fjfr1, d2fjfr2, d2fjfs2, d2fjft1, d2fjft2, d2fjfu2, d2fjfv1, d2fjfv2, d2fjfw2, d2fjfx1, d2fjfx2
   automated match to d1rhha1

Details for d2fjfq1

PDB Entry: 2fjf, 2.65 Å

PDB Description: Structure of the G6 Fab, a phage derived VEGF binding Fab

PDB Compounds: (Q:) Light Chain of a VEGF binding Antibody

SCOPe Domain Sequences for d2fjfq1:

Sequence; same for both SEQRES and ATOM records:

>d2fjfq1 b.1.1.0 (Q:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqdvstavawyqqkpgkapklliysasflysgvps
rfsgsgsgtdftltisslqpedfatyycqqsyttpptfgqgtkveik

Timeline for d2fjfq1:

• d2fjfq1 first appeared in SCOPe 2.03
  
• d2fjfq1 appears in SCOPe 2.04
  
• d2fjfq1 appears in SCOPe 2.06
  
• d2fjfq1 appears in the current release, SCOPe 2.08