Lineage for d1hild1 (1hil D:1-112)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52002Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)
  8. 52006Domain d1hild1: 1hil D:1-112 [19789]
    Other proteins in same PDB: d1hila2, d1hilb2, d1hilc2, d1hild2

Details for d1hild1

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hild1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hild1 b.1.1.1 (D:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvs

SCOP Domain Coordinates for d1hild1:

Click to download the PDB-style file with coordinates for d1hild1.
(The format of our PDB-style files is described here.)

Timeline for d1hild1: