Lineage for d1hilc1 (1hil C:1-108)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930786Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)
  8. 930801Domain d1hilc1: 1hil C:1-108 [19788]
    Other proteins in same PDB: d1hila2, d1hilb1, d1hilb2, d1hilc2, d1hild1, d1hild2
    part of Fab 17/9

Details for d1hilc1

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition
PDB Compounds: (C:) igg2a-kappa 17/9 fab (light chain)

SCOPe Domain Sequences for d1hilc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hilc1 b.1.1.1 (C:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

SCOPe Domain Coordinates for d1hilc1:

Click to download the PDB-style file with coordinates for d1hilc1.
(The format of our PDB-style files is described here.)

Timeline for d1hilc1: