SCOP 1.65: Domain d1hilc1: 1hil C:1-108

Lineage for d1hilc1 (1hil C:1-108)

Root: SCOP 1.65
Class b: All beta proteins [48724] (126 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (22 PDB entries)
Domain d1hilc1: 1hil C:1-108 [19788]
Other proteins in same PDB: d1hila2, d1hilb1, d1hilb2, d1hilc2, d1hild1, d1hild2
part of Fab 17/9

Details for d1hilc1

PDB Entry: 1hil (more details), 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hilc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hilc1 b.1.1.1 (C:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

SCOP Domain Coordinates for d1hilc1:

Click to download the PDB-style file with coordinates for d1hilc1.
(The format of our PDB-style files is described here.)

Timeline for d1hilc1: