SCOP 1.55: Domain d1hilc1: 1hil C:1-108

Lineage for d1hilc1 (1hil C:1-108)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)

8. Domain d1hilc1: 1hil C:1-108 [19788]
   Other proteins in same PDB: d1hila2, d1hilb2, d1hilc2, d1hild2

Details for d1hilc1

PDB Entry: 1hil, 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hilc1:

Sequence; same for both SEQRES and ATOM records:

>d1hilc1 b.1.1.1 (C:1-108) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
divmtqspssltvtagekvtmsctssqslfnsgkqknyltwyqqkpgqppkvliywastr
esgvpdrftgsgsgtdftltissvqaedlavyycqndysnpltfgggtklelkr

Timeline for d1hilc1:

• d1hilc1 appears in SCOP 1.57
  
• d1hilc1 appears in the current release, SCOPe 2.08