SCOPe 2.06: Domain d2eigb_: 2eig B:

Lineage for d2eigb_ (2eig B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Lotus tetragonolobus [TaxId:3868] [188358] (1 PDB entry)

8. Domain d2eigb_: 2eig B: [197879]
   automated match to d2eigd_
   complexed with ca, mn, nag

Details for d2eigb_

PDB Entry: 2eig, 2 Å

PDB Description: lotus tetragonolobus seed lectin (isoform)

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d2eigb_:

Sequence; same for both SEQRES and ATOM records:

>d2eigb_ b.29.1.0 (B:) automated matches {Lotus tetragonolobus [TaxId: 3868]}
vsfnytrfkddgslifqgdakiwtdgrlamptdplvnrttshalyatpvpiwdsatgnva
sfitsfsfivsnvqrypptdgvvfflapwgteippnsqggylgitdssnsqnqfvavefd
shpnvwdpkslrsshigidvnsimslkavnwnrvsgslekatiiydsdtkiltvvmthqn
gqittisqeidlktvlpekvsvgfsattwnpererhdiyswsftstlkep

Timeline for d2eigb_:

• d2eigb_ first appeared in SCOPe 2.03
  
• d2eigb_ appears in SCOPe 2.05
  
• d2eigb_ appears in SCOPe 2.07
  
• d2eigb_ appears in the current release, SCOPe 2.08