SCOP 1.61: Domain d1hilb1: 1hil B:1-112

Lineage for d1hilb1 (1hil B:1-112)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)

7. Species Fab 17/9 (mouse), kappa L chain [48757] (4 PDB entries)

8. Domain d1hilb1: 1hil B:1-112 [19787]
   Other proteins in same PDB: d1hila2, d1hilb2, d1hilc2, d1hild2

Details for d1hilb1

PDB Entry: 1hil, 2 Å

PDB Description: structural evidence for induced fit as a mechanism for antigen-antibody recognition

SCOP Domain Sequences for d1hilb1:

Sequence; same for both SEQRES and ATOM records:

>d1hilb1 b.1.1.1 (B:1-112) Immunoglobulin (variable domains of L and H chains) {Fab 17/9 (mouse), kappa L chain}
evqlvesggdlvkpggslklscaasgfsfssygmswvrqtpdkrlewvatisngggytyy
pdsvkgrftisrdnakntlylqmsslksedsamyycarrerydengfaywgqgtlvtvs

Timeline for d1hilb1:

• d1hilb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hilb1 appears in SCOP 1.59
  
• d1hilb1 appears in SCOP 1.63
  
• d1hilb1 appears in the current release, SCOPe 2.08