SCOPe 2.03: Domain d2dtml2: 2dtm L:108-213

Lineage for d2dtml2 (2dtm L:108-213)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (12 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries)

8. Domain d2dtml2: 2dtm L:108-213 [197859]
   Other proteins in same PDB: d2dtmh1, d2dtml1
   automated match to d1blna2

Details for d2dtml2

PDB Entry: 2dtm, 2.25 Å

PDB Description: Thermodynamic and structural analyses of hydrolytic mechanism by catalytic antibodies

PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d2dtml2:

Sequence; same for both SEQRES and ATOM records:

>d2dtml2 b.1.1.2 (L:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d2dtml2:

• d2dtml2 is new in SCOPe 2.03-stable
  
• d2dtml2 appears in SCOPe 2.04
  
• d2dtml2 appears in the current release, SCOPe 2.08