SCOPe 2.06: Domain d2dqul1: 2dqu L:1-107

Lineage for d2dqul1 (2dqu L:1-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d2dqul1: 2dqu L:1-107 [197856]
   Other proteins in same PDB: d2dquh1, d2dqul2
   automated match to d1blna1
   complexed with cpd

Details for d2dqul1

PDB Entry: 2dqu, 1.7 Å

PDB Description: Crystal form II: high resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and a transition-state analog

PDB Compounds: (L:) immunoglobulin 6d9

SCOPe Domain Sequences for d2dqul1:

Sequence; same for both SEQRES and ATOM records:

>d2dqul1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvslgdqasiscrssqtivhsngdtyldwflqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpptfgggtkleik

Timeline for d2dqul1:

• d2dqul1 first appeared in SCOPe 2.03
  
• d2dqul1 appears in SCOPe 2.05
  
• d2dqul1 appears in SCOPe 2.07
  
• d2dqul1 appears in the current release, SCOPe 2.08