Class b: All beta proteins [48724] (177 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
Protein Rho guanine nucleotide exchange factor 9, Collybistin [159209] (1 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [159210] (1 PDB entry) Uniprot Q9QX73 300-461 |
Domain d2dfkc2: 2dfk C:240-397 [197853] Other proteins in same PDB: d2dfka1, d2dfkb_, d2dfkc1, d2dfkd2, d2dfkd3 automated match to d2dfka2 complexed with gol, so4 |
PDB Entry: 2dfk (more details), 2.15 Å
SCOPe Domain Sequences for d2dfkc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dfkc2 b.55.1.1 (C:240-397) Rho guanine nucleotide exchange factor 9, Collybistin {Norway rat (Rattus norvegicus) [TaxId: 10116]} nidkiaqwqasvldwegddildrsseliytgemawiyqpygrnqqrvfflfdhqmvlckk dlirrdilyykgridmdkyevidiedgrdddfnvsmknafklhnketeevhlffakklee kirwlrafreerkmvqedekigfeisenqkrqaamtvr
Timeline for d2dfkc2: