SCOPe 2.07: Domain d2d03l1: 2d03 L:2-114

Lineage for d2d03l1 (2d03 L:2-114)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d2d03l1: 2d03 L:2-114 [197847]
   Other proteins in same PDB: d2d03h1, d2d03l2
   automated match to d2jell1
   complexed with gol, mes, peg; mutant

Details for d2d03l1

PDB Entry: 2d03, 1.97 Å

PDB Description: Crystal structure of the G91S mutant of the NNA7 Fab

PDB Compounds: (L:) anti-glycophorin A type N immunoglobulin light chain

SCOPe Domain Sequences for d2d03l1:

Sequence; same for both SEQRES and ATOM records:

>d2d03l1 b.1.1.1 (L:2-114) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqsplslpvslgdqasiscrssqslvhssgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftltisrveaedlgvyycfqsshvpltfgagtklelkr

Timeline for d2d03l1:

• d2d03l1 first appeared in SCOPe 2.03
  
• d2d03l1 appears in SCOPe 2.06
  
• d2d03l1 appears in the current release, SCOPe 2.08