SCOP 1.73: Domain d1bbjl1: 1bbj L:1-109

Lineage for d1bbjl1 (1bbj L:1-109)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
Domain d1bbjl1: 1bbj L:1-109 [19784]
Other proteins in same PDB: d1bbja2, d1bbjb1, d1bbjb2, d1bbjh1, d1bbjh2, d1bbjl2
part of humanized Fab B72.3

Details for d1bbjl1

PDB Entry: 1bbj (more details), 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

PDB Compounds: (L:) igg4-kappa b72.3 fab (light chain)

SCOP Domain Sequences for d1bbjl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bbjl1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqspaslsvsvgetvtitcraseniysnlawyqqkqgkspqllvyaatnladgvps
rfsgsgsgtqyslkinslqsedfgsyycqhfwgtpytfgggtrleikra

SCOP Domain Coordinates for d1bbjl1:

Click to download the PDB-style file with coordinates for d1bbjl1.
(The format of our PDB-style files is described here.)

Timeline for d1bbjl1: