SCOP 1.55: Domain d1bbjl1: 1bbj L:1-109

Lineage for d1bbjl1 (1bbj L:1-109)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab B72.3 (mouse/human chimera), kappa L chain [48756] (1 PDB entry)

8. Domain d1bbjl1: 1bbj L:1-109 [19784]
   Other proteins in same PDB: d1bbjh2, d1bbjl2

Details for d1bbjl1

PDB Entry: 1bbj, 3.1 Å

PDB Description: crystal structure of a chimeric fab' fragment of an antibody binding tumour cells

SCOP Domain Sequences for d1bbjl1:

Sequence; same for both SEQRES and ATOM records:

>d1bbjl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab B72.3 (mouse/human chimera), kappa L chain}
diqmtqspaslsvsvgetvtitcraseniysnlawyqqkqgkspqllvyaatnladgvps
rfsgsgsgtqyslkinslqsedfgsyycqhfwgtpytfgggtrleikra

Timeline for d1bbjl1:

• d1bbjl1 appears in SCOP 1.57
  
• d1bbjl1 appears in the current release, SCOPe 2.08