Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.0: automated matches [191339] (1 protein) not a true family |
Protein automated matches [190218] (22 species) not a true protein |
Species Sphingomonas sp. [TaxId:279135] [225202] (1 PDB entry) |
Domain d2ckfc2: 2ckf C:153-446 [197837] Other proteins in same PDB: d2ckfa1, d2ckfb_, d2ckfc1, d2ckfd_, d2ckfe1, d2ckff_ automated match to d1eg9a2 complexed with fe, fes |
PDB Entry: 2ckf (more details), 1.85 Å
SCOPe Domain Sequences for d2ckfc2:
Sequence, based on SEQRES records: (download)
>d2ckfc2 d.129.3.0 (C:153-446) automated matches {Sphingomonas sp. [TaxId: 279135]} eapsledylgefrfyldtiwegggaglellgppmksllhcnwkvpvenfvgdgyhvgwth aaalgqiggplaglagnradipfddlglqfttrhghgfgvidnaaaaihrkgdgwnkyle dtrgevrrkfgadrerlyvghwngaifpncsflygtntfkiwhprgpheievwtytmvps dadpatksaiqreatrtfgtagtlesddgenmssatyvnrgvitrdgmmnstmgvgyegp hpvypgivgisfigetsyrgfyrfwkemidapdwasvkanddnwdsvftnrnfw
>d2ckfc2 d.129.3.0 (C:153-446) automated matches {Sphingomonas sp. [TaxId: 279135]} eapsledylgefrfyldtiwegggaglellgppmksllhcnwkvpvenfvgdgyhvgwth aaallglqfttrhghgfgvidnaaaaihrkgdgwnkyledtrgevrrkfgadrerlyvgh wngaifpncsflygtntfkiwhprgpheievwtytmvpsdadpatksaiqreatrtfgta gtlesddgenmssatyvnrgvitrdgmmnstmgvgyegphpvypgivgisfigetsyrgf yrfwkemidapdwasvkanddnwdsvftnrnfw
Timeline for d2ckfc2: