Class b: All beta proteins [48724] (176 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.0: automated matches [191455] (1 protein) not a true family |
Protein automated matches [190701] (10 species) not a true protein |
Species Sphingomonas sp. [TaxId:279135] [225201] (1 PDB entry) |
Domain d2ckfc1: 2ckf C:1-152 [197836] Other proteins in same PDB: d2ckfa2, d2ckfb_, d2ckfc2, d2ckfd_, d2ckfe2, d2ckff_ automated match to d1o7na1 complexed with fe, fes |
PDB Entry: 2ckf (more details), 1.85 Å
SCOPe Domain Sequences for d2ckfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ckfc1 b.33.1.0 (C:1-152) automated matches {Sphingomonas sp. [TaxId: 279135]} msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples rcyhnkldkqelaaksvrvetykgfifgchdp
Timeline for d2ckfc1: