Lineage for d2ckfa1 (2ckf A:1-152)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309647Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 1309648Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 1309840Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 1309841Protein automated matches [190701] (8 species)
    not a true protein
  7. 1309915Species Sphingomonas sp. [TaxId:279135] [225201] (1 PDB entry)
  8. 1309916Domain d2ckfa1: 2ckf A:1-152 [197834]
    Other proteins in same PDB: d2ckfa2, d2ckfb_, d2ckfc2, d2ckfd_, d2ckfe2, d2ckff_
    automated match to d1o7na1
    complexed with fe, fes

Details for d2ckfa1

PDB Entry: 2ckf (more details), 1.85 Å

PDB Description: crystal structure of the terminal component of the pah-hydroxylating dioxygenase from sphingomonas sp chy-1
PDB Compounds: (A:) ring-hydroxylating dioxygenase alpha subunit

SCOPe Domain Sequences for d2ckfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckfa1 b.33.1.0 (A:1-152) automated matches {Sphingomonas sp. [TaxId: 279135]}
msgdttlvdtvnasqsrqvfwdrdvydleierifsrawlmlghksllpkpgdfittymae
dkiilshqsdgtfrafinscthrgnqichadsgnakafvcnyhgwvygqdgslvdvples
rcyhnkldkqelaaksvrvetykgfifgchdp

SCOPe Domain Coordinates for d2ckfa1:

Click to download the PDB-style file with coordinates for d2ckfa1.
(The format of our PDB-style files is described here.)

Timeline for d2ckfa1: