Lineage for d2c1dg2 (2c1d G:180-290)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981426Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981427Protein automated matches [190453] (22 species)
    not a true protein
  7. 1981487Species Paracoccus denitrificans [TaxId:266] [225029] (1 PDB entry)
  8. 1981495Domain d2c1dg2: 2c1d G:180-290 [197832]
    automated match to d1h32a2
    complexed with hec, zn

Details for d2c1dg2

PDB Entry: 2c1d (more details), 1.92 Å

PDB Description: crystal structure of soxxa from p. pantotrophus
PDB Compounds: (G:) soxa

SCOPe Domain Sequences for d2c1dg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c1dg2 a.3.1.0 (G:180-290) automated matches {Paracoccus denitrificans [TaxId: 266]}
idgpaapywehgkeiyytrygqlemscanchednagnmiradhlsqgqingfptyrlkds
gmvtaqhrfvgcvrdtraetfkagsddfkalelyvasrgnglsvegvsvrh

SCOPe Domain Coordinates for d2c1dg2:

Click to download the PDB-style file with coordinates for d2c1dg2.
(The format of our PDB-style files is described here.)

Timeline for d2c1dg2: