SCOP 1.63: Domain d1bbdh1: 1bbd H:1-119

Lineage for d1bbdh1 (1bbd H:1-119)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 8F5 (mouse), kappa L chain [48755] (2 PDB entries)

8. Domain d1bbdh1: 1bbd H:1-119 [19783]
   Other proteins in same PDB: d1bbdh2, d1bbdl2
   complexed with so4

Details for d1bbdh1

PDB Entry: 1bbd, 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2

SCOP Domain Sequences for d1bbdh1:

Sequence; same for both SEQRES and ATOM records:

>d1bbdh1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
evqlqqsgaelvrpgasvklscttsgfnikdiyihwvkqrpeqglewigrldpangytky
dpkfqgkatitvdtssntaylhlssltsedtavyycdgyysyydmdywgpgtsvtvssa

Timeline for d1bbdh1:

• d1bbdh1 first appeared (with stable ids) in SCOP 1.55
  
• d1bbdh1 appears in SCOP 1.61
  
• d1bbdh1 appears in SCOP 1.65
  
• d1bbdh1 appears in the current release, SCOPe 2.08