SCOP 1.75: Domain d1bbdl1: 1bbd L:1-114

Lineage for d1bbdl1 (1bbd L:1-114)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (36 PDB entries)

8. Domain d1bbdl1: 1bbd L:1-114 [19782]
   Other proteins in same PDB: d1bbdh1, d1bbdh2, d1bbdl2
   part of Fab 8F5
   complexed with so4

Details for d1bbdl1

PDB Entry: 1bbd, 2.8 Å

PDB Description: three dimensional structure of the fab fragment of a neutralizing antibody to human rhinovirus serotype 2

PDB Compounds: (L:) igg2a-kappa 8f5 fab (light chain)

SCOP Domain Sequences for d1bbdl1:

Sequence; same for both SEQRES and ATOM records:

>d1bbdl1 b.1.1.1 (L:1-114) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkr

Timeline for d1bbdl1:

• d1bbdl1 first appeared (with stable ids) in SCOP 1.55
  
• d1bbdl1 appears in SCOP 1.73
  
• d1bbdl1 appears in SCOPe 2.01
  
• d1bbdl1 appears in the current release, SCOPe 2.08