SCOPe 2.03: Domain d2bozh2: 2boz H:36-251

Lineage for d2bozh2 (2boz H:36-251)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (78 PDB entries)
   Uniprot P11846

8. Domain d2bozh2: 2boz H:36-251 [197804]
   Other proteins in same PDB: d2bozh1, d2bozl_, d2bozm1
   automated match to d1l9bh1
   complexed with bcl, bph, d10, fe, lda, po4, spn, u10; mutant

Details for d2bozh2

PDB Entry: 2boz, 2.4 Å

PDB Description: Photosynthetic Reaction Center Mutant With Gly M203 Replaced With Leu

PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d2bozh2:

Sequence; same for both SEQRES and ATOM records:

>d2bozh2 b.41.1.1 (H:36-251) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrksv

Timeline for d2bozh2:

• d2bozh2 is new in SCOPe 2.03-stable
  
• d2bozh2 appears in SCOPe 2.04
  
• d2bozh2 appears in the current release, SCOPe 2.08