SCOP 1.63: Domain d1a3rl1: 1a3r L:1-114

Lineage for d1a3rl1 (1a3r L:1-114)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab 8F5 (mouse), kappa L chain [48755] (2 PDB entries)

8. Domain d1a3rl1: 1a3r L:1-114 [19780]
   Other proteins in same PDB: d1a3rh2, d1a3rl2

Details for d1a3rl1

PDB Entry: 1a3r, 2.1 Å

PDB Description: fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)

SCOP Domain Sequences for d1a3rl1:

Sequence; same for both SEQRES and ATOM records:

>d1a3rl1 b.1.1.1 (L:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 8F5 (mouse), kappa L chain}
divmtqspssltvttgekvtmtckssqsllnsrtqknyltwyqqkpgqspklliywastr
esgvpdrftgsgsgtdftlsisgvqaedlavyycqnnynypltfgagtklelkradaapt

Timeline for d1a3rl1:

• d1a3rl1 first appeared (with stable ids) in SCOP 1.55
  
• d1a3rl1 appears in SCOP 1.61
  
• d1a3rl1 appears in SCOP 1.65
  
• d1a3rl1 appears in the current release, SCOPe 2.08