![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins) automatically mapped to Pfam PF09028 |
![]() | Protein automated matches [193829] (1 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:293653] [193830] (1 PDB entry) |
![]() | Domain d2avwe_: 2avw E: [197773] automated match to d2avwf_ complexed with gol, so4 |
PDB Entry: 2avw (more details), 2 Å
SCOPe Domain Sequences for d2avwe_:
Sequence, based on SEQRES records: (download)
>d2avwe_ d.3.1.12 (E:) automated matches {Streptococcus pyogenes [TaxId: 293653]} evtpyhvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagn mlhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekaf pylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqskll tsrhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiy vtdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqt
>d2avwe_ d.3.1.12 (E:) automated matches {Streptococcus pyogenes [TaxId: 293653]} evtpyvtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnm lhwwfdqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafp ylstkhlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqskllt srhdfkeknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyv tdsdsnasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswnqt
Timeline for d2avwe_: