Lineage for d2avwc_ (2avw C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1398964Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1398965Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1399605Family d.3.1.12: IgG-specific endopeptidase IdeS (Sib38) [117762] (2 proteins)
    automatically mapped to Pfam PF09028
  6. 1399610Protein automated matches [193829] (1 species)
    not a true protein
  7. 1399611Species Streptococcus pyogenes [TaxId:293653] [193830] (1 PDB entry)
  8. 1399614Domain d2avwc_: 2avw C: [197771]
    automated match to d2avwf_
    complexed with gol, so4

Details for d2avwc_

PDB Entry: 2avw (more details), 2 Å

PDB Description: crystal structure of monoclinic form of streptococcus mac-1
PDB Compounds: (C:) IgG-degrading protease

SCOPe Domain Sequences for d2avwc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2avwc_ d.3.1.12 (C:) automated matches {Streptococcus pyogenes [TaxId: 293653]}
vtsvwtkgvtppanftqgedvfhapyvanqgwyditktfngkddllagaatagnmlhwwf
dqnkdqikryleehpekqkinfngeqmfdvkeaidtknhqldsklfeyfkekafpylstk
hlgvfpdhvidmfingyrlsltnhgptpvkegskdprggifdavftrgdqsklltsrhdf
keknlkeisdlikkeltegkalglshtyanvrinhvinlwgadfdsngnlkaiyvtdsds
nasigmkkyfvgvnsagkvaisakeikednigaqvlglftlstgqdswn

SCOPe Domain Coordinates for d2avwc_:

Click to download the PDB-style file with coordinates for d2avwc_.
(The format of our PDB-style files is described here.)

Timeline for d2avwc_: