SCOPe 2.03: Domain d2ausc2: 2aus C:249-334

Lineage for d2ausc2 (2aus C:249-334)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.0: automated matches [191599] (1 protein)
   not a true family

6. Protein automated matches [191089] (6 species)
   not a true protein

7. Species Pyrococcus abyssi [TaxId:29292] [225092] (1 PDB entry)

8. Domain d2ausc2: 2aus C:249-334 [197768]
   Other proteins in same PDB: d2ausa1, d2ausb_, d2ausc1, d2ausd_
   automated match to d2apoa1
   complexed with po4, zn

Details for d2ausc2

PDB Entry: 2aus, 2.1 Å

PDB Description: crystal structure of the archaeal box h/aca srnp nop10-cbf5 complex

PDB Compounds: (C:) pseudouridine synthase

SCOPe Domain Sequences for d2ausc2:

Sequence; same for both SEQRES and ATOM records:

>d2ausc2 b.122.1.0 (C:249-334) automated matches {Pyrococcus abyssi [TaxId: 29292]}
hlpkiwikdsavaavahganltvpgivklnagikkgdlvaimtlkdelvalgkammstqe
mierskgiavdvekvfmprdwypklw

Timeline for d2ausc2:

• d2ausc2 is new in SCOPe 2.03-stable
  
• d2ausc2 appears in SCOPe 2.04
  
• d2ausc2 appears in the current release, SCOPe 2.08