SCOPe 2.05: Domain d2ai0o2: 2ai0 O:114-217

Lineage for d2ai0o2 (2ai0 O:114-217)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d2ai0o2: 2ai0 O:114-217 [197756]
   Other proteins in same PDB: d2ai0h1, d2ai0i1, d2ai0j1, d2ai0k1, d2ai0l1, d2ai0m1, d2ai0n1, d2ai0o1
   automated match to d2jell2
   complexed with gol, so4

Details for d2ai0o2

PDB Entry: 2ai0, 2.2 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form iii

PDB Compounds: (O:) immunoglobulin light chain kappa

SCOPe Domain Sequences for d2ai0o2:

Sequence; same for both SEQRES and ATOM records:

>d2ai0o2 b.1.1.0 (O:114-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d2ai0o2:

• d2ai0o2 first appeared in SCOPe 2.03
  
• d2ai0o2 appears in SCOPe 2.04
  
• d2ai0o2 appears in SCOPe 2.06
  
• d2ai0o2 appears in the current release, SCOPe 2.08