SCOPe 2.04: Domain d2ai0m1: 2ai0 M:1-113

Lineage for d2ai0m1 (2ai0 M:1-113)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)

8. Domain d2ai0m1: 2ai0 M:1-113 [197751]
   Other proteins in same PDB: d2ai0h1, d2ai0i1, d2ai0j1, d2ai0k1, d2ai0l2, d2ai0m2, d2ai0n2, d2ai0o2
   automated match to d2jell1
   complexed with gol, so4

Details for d2ai0m1

PDB Entry: 2ai0, 2.2 Å

PDB Description: anti-cocaine antibody 7.5.21, crystal form iii

PDB Compounds: (M:) immunoglobulin light chain kappa

SCOPe Domain Sequences for d2ai0m1:

Sequence; same for both SEQRES and ATOM records:

>d2ai0m1 b.1.1.1 (M:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqsplslpvslgdqasiscrcsqsivksnghtylewylqkpgrspklliykvsnrf
sgvpdrfsgsgsgtdftlrisrveaedlgvyycfqgshipwtfgggtkleskr

Timeline for d2ai0m1:

• d2ai0m1 first appeared in SCOPe 2.03
  
• d2ai0m1 appears in SCOPe 2.05
  
• d2ai0m1 appears in the current release, SCOPe 2.08