Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
Species Fab HIL (human), lambda L chain [48752] (1 PDB entry) |
Domain d8fabc1: 8fab C:3-105 [19774] Other proteins in same PDB: d8faba2, d8fabb2, d8fabc2, d8fabd2 |
PDB Entry: 8fab (more details), 1.8 Å
SCOP Domain Sequences for d8fabc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8fabc1 b.1.1.1 (C:3-105) Immunoglobulin (variable domains of L and H chains) {Fab HIL (human), lambda L chain} eltqppsvsvspgqtaritcsanalpnqyaywyqqkpgrapvmviykdtqrpsgipqrfs sstsgttvtltisgvqaedeadyycqawdnsasifgggtkltv
Timeline for d8fabc1: