Lineage for d8fabb1 (8fab B:1-121)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158216Species Fab HIL (human), lambda L chain [48752] (1 PDB entry)
  8. 158218Domain d8fabb1: 8fab B:1-121 [19773]
    Other proteins in same PDB: d8faba2, d8fabb2, d8fabc2, d8fabd2

Details for d8fabb1

PDB Entry: 8fab (more details), 1.8 Å

PDB Description: crystal structure of the fab fragment from the human myeloma immunoglobulin igg hil at 1.8 angstroms resolution

SCOP Domain Sequences for d8fabb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d8fabb1 b.1.1.1 (B:1-121) Immunoglobulin (variable domains of L and H chains) {Fab HIL (human), lambda L chain}
avklvqagggvvqpgrslrlsciasgftfsnygmhwvrqapgkglewvaviwyngsrtyy
gdsvkgrftisrdnskrtlymqmnslrtedtavyycardpdiltafsfdywgqgvlvtvs
s

SCOP Domain Coordinates for d8fabb1:

Click to download the PDB-style file with coordinates for d8fabb1.
(The format of our PDB-style files is described here.)

Timeline for d8fabb1: