Lineage for d2a19a2 (2a19 A:89-174)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2001088Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2002281Superfamily a.60.14: eIF2alpha middle domain-like [116742] (2 families) (S)
  5. 2002295Family a.60.14.0: automated matches [227301] (1 protein)
    not a true family
  6. 2002296Protein automated matches [227127] (1 species)
    not a true protein
  7. 2002297Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226786] (2 PDB entries)
  8. 2002298Domain d2a19a2: 2a19 A:89-174 [197724]
    Other proteins in same PDB: d2a19a1, d2a19a3, d2a19b1, d2a19b2, d2a19c1, d2a19c2
    automated match to d1kl9a1
    complexed with anp, mg, po4

Details for d2a19a2

PDB Entry: 2a19 (more details), 2.5 Å

PDB Description: pkr kinase domain- eif2alpha- amp-pnp complex.
PDB Compounds: (A:) Eukaryotic translation initiation factor 2 alpha subunit

SCOPe Domain Sequences for d2a19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a19a2 a.60.14.0 (A:89-174) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vssediikceekyqksktvhsilrycaekfqipleelyktiawplsrkfghayeafklsi
idetvwegieppskdvldelknyisk

SCOPe Domain Coordinates for d2a19a2:

Click to download the PDB-style file with coordinates for d2a19a2.
(The format of our PDB-style files is described here.)

Timeline for d2a19a2: