Class b: All beta proteins [48724] (180 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins) |
Protein ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain [50024] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [50025] (20 PDB entries) |
Domain d2a06r2: 2a06 R:70-196 [197721] Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06r1, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_ automated match to d1ntme1 complexed with azi, cdl, fes, gol, hec, hem, jzr, pee, po4, sma, unl, uq |
PDB Entry: 2a06 (more details), 2.1 Å
SCOPe Domain Sequences for d2a06r2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a06r2 b.33.1.1 (R:70-196) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts ddmvivg
Timeline for d2a06r2:
View in 3D Domains from other chains: (mouse over for more information) d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06c2, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06p2, d2a06q1, d2a06q2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_ |