SCOPe 2.03: Domain d2a06p2: 2a06 P:261-379

Lineage for d2a06p2 (2a06 P:261-379)

1. Root: SCOPe 2.03

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
   core: three transmembrane helices, up-and-down bundle

4. Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family)

5. Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
   a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81643] (18 PDB entries)
   Uniprot P00157

8. Domain d2a06p2: 2a06 P:261-379 [197719]
   Other proteins in same PDB: d2a06a1, d2a06a2, d2a06b1, d2a06b2, d2a06c1, d2a06d1, d2a06d2, d2a06e1, d2a06e2, d2a06f_, d2a06g_, d2a06h_, d2a06i_, d2a06j_, d2a06n1, d2a06n2, d2a06o1, d2a06o2, d2a06p1, d2a06q1, d2a06q2, d2a06r1, d2a06r2, d2a06s_, d2a06t_, d2a06u_, d2a06v_, d2a06w_
   automated match to d1ntmc1
   complexed with azi, bhg, cdl, fes, gol, hec, hem, pee, po4, sma, unl, uq

Details for d2a06p2

PDB Entry: 2a06, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin bound

PDB Compounds: (P:) Cytochrome b, heme protein, mitochondrial

SCOPe Domain Sequences for d2a06p2:

Sequence; same for both SEQRES and ATOM records:

>d2a06p2 f.32.1.1 (P:261-379) Mitochondrial cytochrome b subunit, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
plntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrsmmfrpl
sqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtienkllkw

Timeline for d2a06p2:

• d2a06p2 is new in SCOPe 2.03-stable
  
• d2a06p2 appears in SCOPe 2.04
  
• d2a06p2 appears in the current release, SCOPe 2.08