Lineage for d1igyd1 (1igy D:2-113)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 450780Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)
  6. 450916Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 451214Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)
  8. 451379Domain d1igyd1: 1igy D:2-113 [19771]
    Other proteins in same PDB: d1igya1, d1igya2, d1igyb2, d1igyb3, d1igyb4, d1igyc1, d1igyc2, d1igyd2, d1igyd3, d1igyd4
    part of intact IgG1 antibody Mab61.1.3

Details for d1igyd1

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyd1 b.1.1.1 (D:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvss

SCOP Domain Coordinates for d1igyd1:

Click to download the PDB-style file with coordinates for d1igyd1.
(The format of our PDB-style files is described here.)

Timeline for d1igyd1: