Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48751] (1 PDB entry) |
Domain d1igyd1: 1igy D:2-113 [19771] Other proteins in same PDB: d1igya2, d1igyb2, d1igyb3, d1igyb4, d1igyc2, d1igyd2, d1igyd3, d1igyd4 |
PDB Entry: 1igy (more details), 3.2 Å
SCOP Domain Sequences for d1igyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igyd1 b.1.1.1 (D:2-113) Immunoglobulin (variable domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain} vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvss
Timeline for d1igyd1: