Lineage for d1igyd1 (1igy D:2-113)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7955Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48751] (1 PDB entry)
  8. 7959Domain d1igyd1: 1igy D:2-113 [19771]
    Other proteins in same PDB: d1igya2, d1igyb2, d1igyb3, d1igyb4, d1igyc2, d1igyd2, d1igyd3, d1igyd4

Details for d1igyd1

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyd1 b.1.1.1 (D:2-113) Immunoglobulin (variable domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain}
vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvss

SCOP Domain Coordinates for d1igyd1:

Click to download the PDB-style file with coordinates for d1igyd1.
(The format of our PDB-style files is described here.)

Timeline for d1igyd1: