Lineage for d1igyb1 (1igy B:2-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52654Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48751] (1 PDB entry)
  8. 52656Domain d1igyb1: 1igy B:2-113 [19769]
    Other proteins in same PDB: d1igya2, d1igyb2, d1igyb3, d1igyb4, d1igyc2, d1igyd2, d1igyd3, d1igyd4

Details for d1igyb1

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyb1 b.1.1.1 (B:2-113) Immunoglobulin (variable domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain}
vklqesgaelarpgasvkmsckasgytfttytihwikqrpgqglewigyinpssvytnyn
qrfkdkatltrdrssntanihlssltsddsavyycvregevpywgqgttvtvss

SCOP Domain Coordinates for d1igyb1:

Click to download the PDB-style file with coordinates for d1igyb1.
(The format of our PDB-style files is described here.)

Timeline for d1igyb1: