SCOPe 2.04: Domain d1yy9c1: 1yy9 C:1-107

Lineage for d1yy9c1 (1yy9 C:1-107)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d1yy9c1: 1yy9 C:1-107 [197671]
   Other proteins in same PDB: d1yy9a1, d1yy9a2, d1yy9a3, d1yy9a4
   automated match to d1f3dj1
   complexed with nag, ndg

Details for d1yy9c1

PDB Entry: 1yy9, 2.6 Å

PDB Description: structure of the extracellular domain of the epidermal growth factor receptor in complex with the fab fragment of cetuximab/erbitux/imc- c225

PDB Compounds: (C:) Cetuximab Fab Light chain

SCOPe Domain Sequences for d1yy9c1:

Sequence; same for both SEQRES and ATOM records:

>d1yy9c1 b.1.1.0 (C:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dilltqspvilsvspgervsfscrasqsigtnihwyqqrtngsprllikyasesisgips
rfsgsgsgtdftlsinsvesediadyycqqnnnwpttfgagtklelk

Timeline for d1yy9c1:

• d1yy9c1 first appeared in SCOPe 2.03
  
• d1yy9c1 appears in SCOPe 2.05
  
• d1yy9c1 appears in the current release, SCOPe 2.08